Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PINK1 Peptide - N-terminal region

PINK1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BRPK, FLJ27236, PARK6

UniProt

Q9BXM7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PINK1 Rabbit Polyclonal Antibody (orb331223) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115785

Preservative

Lyophilized powder

AA Sequence

GCAGPCGRAVFLAFGLGLGLIEEKQAESRRAVSACQEIQAIFTQKSKPGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTAR1 (NM_001099666) Human Over-expression Lysate
LC420480 20 µg

PTAR1 (NM_001099666) Human Over-expression Lysate

Sign In for Pricing
View Details
CYP21A2 (N-term) Rabbit Polyclonal Antibody
AP14730PU-N 400 µL

CYP21A2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TSGA10 antibody
FNab09042 100 µg

TSGA10 antibody

Sign In for Pricing
View Details
Tissue Genomic DNA, Lung
CD563655 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details
Acid Red 91
TRC-A795298-1G 1 g

Acid Red 91

Sign In for Pricing
View Details
TentaGel® S Sieber Resin
S30024.50G 50 g

TentaGel® S Sieber Resin

Sign In for Pricing
View Details