Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC2A3 Peptide - middle region

SLC2A3 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ90380, GLUT3

UniProt

P11169

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC2A3 Rabbit Polyclonal Antibody (orb585610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008862

Preservative

Lyophilized powder

AA Sequence

EELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLW

More Discoveries

Explore Other Products

Browse additional items from our catalog

PYR Reagent
879350 10 mL

PYR Reagent

Sign In for Pricing
View Details
Rabbit Polyclonal FAM213B Antibody
NBP1-93498-25ul 25 µL

Rabbit Polyclonal FAM213B Antibody

Sign In for Pricing
View Details
Olfr1219 Double Nickase Plasmid (m)
sc-434995-NIC 20 µg

Olfr1219 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
MCART1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
28198151 3x 1.0 µg DNA

MCART1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Recombinant Mouse PLA2G2D (C-FLAG-Fc)
32-10833-50 50 µg

Recombinant Mouse PLA2G2D (C-FLAG-Fc)

Sign In for Pricing
View Details
PRKRIR Protein Lysate (Rat) with C-HA Tag
37657036 100 µg

PRKRIR Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details