Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC2A3 Peptide - middle region

SLC2A3 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ90380, GLUT3

UniProt

P11169

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC2A3 Rabbit Polyclonal Antibody (orb585610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008862

Preservative

Lyophilized powder

AA Sequence

EELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLW

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Bridging Integrator 3 (BIN3) ELISA Kit
MBS9912925 Inquire

Goat Bridging Integrator 3 (BIN3) ELISA Kit

Sign In for Pricing
View Details
HTR3A Protein Vector (Mouse) (pPB-C-His)
PV190298 500 ng

HTR3A Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
TMEM185A (NM_001174092) Human Over-expression Lysate
LC432841 20 µg

TMEM185A (NM_001174092) Human Over-expression Lysate

Sign In for Pricing
View Details
PRAGMIN (PRAG1) (2-102) mouse monoclonal antibody, clone 5C6, Purified
AM31900PU-N 50 µg

PRAGMIN (PRAG1) (2-102) mouse monoclonal antibody, clone 5C6, Purified

Sign In for Pricing
View Details
La-related protein 7 (LARP7) Antibody
abx346328-01 20 µg

La-related protein 7 (LARP7) Antibody

Sign In for Pricing
View Details
La-related protein 7 (LARP7) Antibody
abx346328-02 50 µg

La-related protein 7 (LARP7) Antibody

Sign In for Pricing
View Details