Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGR Peptide - C-terminal region

RGR Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP44

UniProt

P47804

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RGR Rabbit Polyclonal Antibody (orb585624) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012740

Preservative

Lyophilized powder

AA Sequence

GKSGHLQVPALIAKMVPTINAINYALGNEMVCRGIWQCLSPQKREKDRTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akr1c6 Mouse Gene Knockout Kit (CRISPR)
KN501094 1 Kit

Akr1c6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SIRT3 Human Gene Knockout Kit (CRISPR)
KN400190 1 Kit

SIRT3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14/532), CF405S conjugate, 0.1mg/mL
BNC040532-500 1x 500 µL

Cytokeratin 14 (KRT14/532), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tuberin (TSC2) pSer664 Rabbit Polyclonal Antibody
AP12853PU-N 400 µL

Tuberin (TSC2) pSer664 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Spleen
CS804019 5x 5 µm

Tissue FFPE Sections, Spleen

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (rSOX9/2288), Biotin conjugate, 0.1mg/mL
BNCB2288-500 1x 500 µL

SOX9 / SRY-box 9 (rSOX9/2288), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details