Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGR Peptide - C-terminal region

RGR Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP44

UniProt

P47804

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RGR Rabbit Polyclonal Antibody (orb585624) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012740

Preservative

Lyophilized powder

AA Sequence

GKSGHLQVPALIAKMVPTINAINYALGNEMVCRGIWQCLSPQKREKDRTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SV2A Antibody
KC-538-01 50 μL

SV2A Antibody

Sign In for Pricing
View Details
SV2A Antibody
KC-538-02 100 µL

SV2A Antibody

Sign In for Pricing
View Details
SV2A Antibody
KC-538-03 1 mL

SV2A Antibody

Sign In for Pricing
View Details
10Beta-Hydroxyl Dextrorphan 3-O-Beta-D-Glucuronide
TRC-D943845-0.5MG 0.5 mg

10Beta-Hydroxyl Dextrorphan 3-O-Beta-D-Glucuronide

Sign In for Pricing
View Details
SYNGR1 Antibody
KC-1460-01 50 μL

SYNGR1 Antibody

Sign In for Pricing
View Details
SYNGR1 Antibody
KC-1460-02 100 µL

SYNGR1 Antibody

Sign In for Pricing
View Details