Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOR1A Peptide - C-terminal region

TOR1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

DQ2, DYT1

UniProt

O14656

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOR1A Rabbit Polyclonal Antibody (orb585630) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000104

Preservative

Lyophilized powder

AA Sequence

AMFIFLSNAGAERITDVALDFWRSGKQREDIKLKDIEHALSVSVFNNKNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCPS Protein Lysate (Human) with C-Ha Tag
17743031 100 µg

DCPS Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
1H-Phenanthro[1,10,9,8-cdefg]carbazole
JH914796 1 Each

1H-Phenanthro[1,10,9,8-cdefg]carbazole

Sign In for Pricing
View Details
SIRT2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-7350R-BF488 100 µL

SIRT2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Putative odorant receptor 45a (Or45a)
MBS7024865-01 0.02 mg

Recombinant Drosophila melanogaster Putative odorant receptor 45a (Or45a)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Putative odorant receptor 45a (Or45a)
MBS7024865-02 0.1 mg

Recombinant Drosophila melanogaster Putative odorant receptor 45a (Or45a)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Putative odorant receptor 45a (Or45a)
MBS7024865-03 5x 0.1 mg

Recombinant Drosophila melanogaster Putative odorant receptor 45a (Or45a)

Sign In for Pricing
View Details