Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A5 Peptide - N-terminal region

SLC7A5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

4F2LC, CD98, D16S469E, E16, LAT1, MPE16, hLAT1

UniProt

Q01650

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC7A5 Rabbit Polyclonal Antibody (orb585727) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003477

Preservative

Lyophilized powder

AA Sequence

MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Formylnornicotine
TRC-F700875-50MG 50 mg

N-Formylnornicotine

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS800895 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Rat RalA Binding Protein 1 (RALBP1) ELISA Kit
RDR-RALBP1-Ra-01 96 Tests

Rat RalA Binding Protein 1 (RALBP1) ELISA Kit

Sign In for Pricing
View Details
Rat RalA Binding Protein 1 (RALBP1) ELISA Kit
RDR-RALBP1-Ra-02 48 Tests

Rat RalA Binding Protein 1 (RALBP1) ELISA Kit

Sign In for Pricing
View Details
Automatic bed BHBD-419
BHBD-419 1 Unit

Automatic bed BHBD-419

Sign In for Pricing
View Details
Apiin
TRC-A726550-1MG 1 mg

Apiin

Sign In for Pricing
View Details