Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A5 Peptide - N-terminal region

SLC7A5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

4F2LC, CD98, D16S469E, E16, LAT1, MPE16, hLAT1

UniProt

Q01650

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC7A5 Rabbit Polyclonal Antibody (orb585727) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003477

Preservative

Lyophilized powder

AA Sequence

MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdc42se2 (NM_178626) Mouse Tagged ORF Clone
MG200176 10 µg

Cdc42se2 (NM_178626) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MED28 Mouse Monoclonal Antibody [Clone ID: OTI6A3]
CF810136 100 µg

MED28 Mouse Monoclonal Antibody [Clone ID: OTI6A3]

Sign In for Pricing
View Details
CD13 Rabbit Polyclonal Antibody
ER1803-74 100 µL

CD13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ICAM2 (NM_001099788) Human Over-expression Lysate
LY420537 100 µg

ICAM2 (NM_001099788) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Nitrophenyl Propionate
TRC-N926178-25MG 25 mg

4-Nitrophenyl Propionate

Sign In for Pricing
View Details
CYP11B2 Human Gene Knockout Kit (CRISPR)
KN415476 1 Kit

CYP11B2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details