Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPCS Peptide - N-terminal region

PPCS Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ11838, MGC117357, MGC138220, RP11-163G10.1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPCS Rabbit Polyclonal Antibody (orb585734) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078940

Preservative

Lyophilized powder

AA Sequence

FSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant C1s Antibody
RC-16528-01 50 μL

Recombinant C1s Antibody

Sign In for Pricing
View Details
Recombinant C1s Antibody
RC-16528-02 100 µL

Recombinant C1s Antibody

Sign In for Pricing
View Details
Recombinant C1s Antibody
RC-16528-03 1 mL

Recombinant C1s Antibody

Sign In for Pricing
View Details
Human ST6GALNAC1 activation kit by CRISPRa
GA110986 1 Kit

Human ST6GALNAC1 activation kit by CRISPRa

Sign In for Pricing
View Details
LRRC3C Human Gene Knockout Kit (CRISPR)
KN431115 1 Kit

LRRC3C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1700012B09Rik (NM_029306) Mouse Tagged ORF Clone
MG200593 10 µg

1700012B09Rik (NM_029306) Mouse Tagged ORF Clone

Sign In for Pricing
View Details