PPCS Peptide - N-terminal region
PPCS Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ11838, MGC117357, MGC138220, RP11-163G10.1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPCS Rabbit Polyclonal Antibody (orb585734) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_078940
Preservative
Lyophilized powder
AA Sequence
FSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![2-Fluoro-7-aza-spiro[3.5]nonane (~90%)](https://cdn.genprice.uk/products/572/8630435283598/imageurl/trc-f588025-25mg.webp)
LY419845 100 µg
Adducin 2 (ADD2) (NM_001617) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNUB3256-100 1x 100 µL
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/3256), 0.2mg/mL
Sign In for Pricing
View Details