Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A10 Peptide - middle region

S100A10 Peptide - middle region

Product Specifications

Product Name Alternative

42C, ANX2L, ANX2LG, CAL1L, CLP11, Ca[1], GP11, MGC111133, P11, p10

UniProt

P60903

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with S100A10 Rabbit Polyclonal Antibody (orb585738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002957

Preservative

Lyophilized powder

AA Sequence

DPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Hexyl-4-methylpyridin-1-ium bromide
OR1102246-01 5 g

1-Hexyl-4-methylpyridin-1-ium bromide

Sign In for Pricing
View Details
1-Hexyl-4-methylpyridin-1-ium bromide
OR1102246-02 25 g

1-Hexyl-4-methylpyridin-1-ium bromide

Sign In for Pricing
View Details
Human Mac-2 Binding Protein Glycosylation Isomer (M2BPGi) ELISA Kit
orb1736594-01 48 Tests

Human Mac-2 Binding Protein Glycosylation Isomer (M2BPGi) ELISA Kit

Sign In for Pricing
View Details
Human Mac-2 Binding Protein Glycosylation Isomer (M2BPGi) ELISA Kit
orb1736594-02 96 Tests

Human Mac-2 Binding Protein Glycosylation Isomer (M2BPGi) ELISA Kit

Sign In for Pricing
View Details
OR8J2 sgRNA CRISPR Lentivector (Human) (Target 1)
K1545302 1.0 µg DNA

OR8J2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human ABCC9 activation kit by CRISPRa
GA106817 1 Kit

Human ABCC9 activation kit by CRISPRa

Sign In for Pricing
View Details