Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A10 Peptide - middle region

S100A10 Peptide - middle region

Product Specifications

Product Name Alternative

42C, ANX2L, ANX2LG, CAL1L, CLP11, Ca[1], GP11, MGC111133, P11, p10

UniProt

P60903

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with S100A10 Rabbit Polyclonal Antibody (orb585738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002957

Preservative

Lyophilized powder

AA Sequence

DPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAS1C1 Rabbit Polyclonal Antibody (BF405)
orb1595519 100 µL

PAS1C1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Porcine Ornithine Carbamoyl Transferase (OCT) ELISA Kit
EIA06135p 1 Kit

Porcine Ornithine Carbamoyl Transferase (OCT) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Ret Antibody (RET/2795) [Alexa Fluor 405]
NBP2-79897AF405 0.1 mL

Mouse Monoclonal Ret Antibody (RET/2795) [Alexa Fluor 405]

Sign In for Pricing
View Details
Aprataxin Double Nickase Plasmid (m)
sc-426003-NIC 20 µg

Aprataxin Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Mouse PDGFRL ELISA Kit (Ready to Use)
orb553928-01 48 Tests

Mouse PDGFRL ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Mouse PDGFRL ELISA Kit (Ready to Use)
orb553928-02 96 Tests

Mouse PDGFRL ELISA Kit (Ready to Use)

Sign In for Pricing
View Details