Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS3 Peptide - C-terminal region

RPS3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ26283, FLJ27450, MGC87870, S3

UniProt

P23396

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS3 Rabbit Polyclonal Antibody (orb585741) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000996

Preservative

Lyophilized powder

AA Sequence

PWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNJ6 siRNA (Rat)
MBS8227841-01 15 nmol

KCNJ6 siRNA (Rat)

Sign In for Pricing
View Details
KCNJ6 siRNA (Rat)
MBS8227841-02 30 nmol

KCNJ6 siRNA (Rat)

Sign In for Pricing
View Details
KCNJ6 siRNA (Rat)
MBS8227841-03 5x 30 nmol

KCNJ6 siRNA (Rat)

Sign In for Pricing
View Details
4- (N-Maleimido) benzyl-a-trimethylammonium iodide
FM24977-01 5 mg

4- (N-Maleimido) benzyl-a-trimethylammonium iodide

Sign In for Pricing
View Details
4- (N-Maleimido) benzyl-a-trimethylammonium iodide
FM24977-02 10 mg

4- (N-Maleimido) benzyl-a-trimethylammonium iodide

Sign In for Pricing
View Details
4- (N-Maleimido) benzyl-a-trimethylammonium iodide
FM24977-03 25 mg

4- (N-Maleimido) benzyl-a-trimethylammonium iodide

Sign In for Pricing
View Details