Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFRC Peptide - N-terminal region

TFRC Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD71, TFR, TFR1, TRFR, T9, TR, p90

UniProt

P02786

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFRC Rabbit Polyclonal Antibody (orb333738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_003225

Preservative

Lyophilized powder

AA Sequence

GYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTAG1A Antibody
KC-3790-01 50 μL

CTAG1A Antibody

Sign In for Pricing
View Details
CTAG1A Antibody
KC-3790-02 100 µL

CTAG1A Antibody

Sign In for Pricing
View Details
CTAG1A Antibody
KC-3790-03 1 mL

CTAG1A Antibody

Sign In for Pricing
View Details
LGALS3 Antibody
KC-6270-01 50 μL

LGALS3 Antibody

Sign In for Pricing
View Details
LGALS3 Antibody
KC-6270-02 100 µL

LGALS3 Antibody

Sign In for Pricing
View Details
LGALS3 Antibody
KC-6270-03 1 mL

LGALS3 Antibody

Sign In for Pricing
View Details