Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFRC Peptide - N-terminal region

TFRC Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD71, TFR, TFR1, TRFR, T9, TR, p90

UniProt

P02786

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFRC Rabbit Polyclonal Antibody (orb333738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_003225

Preservative

Lyophilized powder

AA Sequence

GYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR2E3 Human Gene Knockout Kit (CRISPR)
KN415425 1 Kit

NR2E3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lypd9 Mouse Gene Knockout Kit (CRISPR)
KN500382 1 Kit

Lypd9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Rat TGF-beta 3/TGFB3 protein (His tag)
PDER100217-01 20 µg

Recombinant Rat TGF-beta 3/TGFB3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat TGF-beta 3/TGFB3 protein (His tag)
PDER100217-02 100 µg

Recombinant Rat TGF-beta 3/TGFB3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat TGF-beta 3/TGFB3 protein (His tag)
PDER100217-03 500 µg

Recombinant Rat TGF-beta 3/TGFB3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat TGF-beta 3/TGFB3 protein (His tag)
PDER100217-04 1 mg

Recombinant Rat TGF-beta 3/TGFB3 protein (His tag)

Sign In for Pricing
View Details