Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BEGAIN Peptide - middle region

BEGAIN Peptide - middle region

Product Specifications

Product Name Alternative

KIAA1446

UniProt

Q9BUH8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BEGAIN Rabbit Polyclonal Antibody (orb585746) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065887

Preservative

Lyophilized powder

AA Sequence

AEAAAFPAGFQHEAFPSYAGSLPTSSSYSSFSATSEEKEHAQASTLTASQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Azidoacetyl-β-D-glucosamine tetraacetate
GC8072-25mg 25 mg

N-Azidoacetyl-β-D-glucosamine tetraacetate

Sign In for Pricing
View Details
Grp78/BiP ELISA kit
ADI-900-214-0001 96 Well

Grp78/BiP ELISA kit

Sign In for Pricing
View Details
Transcription Factor E2F4 (E2F4) Human ELISA Kit
H7226 96 Tests

Transcription Factor E2F4 (E2F4) Human ELISA Kit

Sign In for Pricing
View Details
ZFYVE16
CSB-CL800100HU1 10 μg Plasmid + 200 μL Glycerol

ZFYVE16

Sign In for Pricing
View Details
Lentiviral human ZC2HC1A shRNA (UAS) - Lentiviral human ZC2HC1A shRNA (UAS, RFP) (25)
GTR15307886 1 Vial

Lentiviral human ZC2HC1A shRNA (UAS) - Lentiviral human ZC2HC1A shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
AMOTL1 Knockout Raji Polyclonal Cells
ARG21142 1 Million

AMOTL1 Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details