Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BEGAIN Peptide - middle region

BEGAIN Peptide - middle region

Product Specifications

Product Name Alternative

KIAA1446

UniProt

Q9BUH8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BEGAIN Rabbit Polyclonal Antibody (orb585746) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065887

Preservative

Lyophilized powder

AA Sequence

AEAAAFPAGFQHEAFPSYAGSLPTSSSYSSFSATSEEKEHAQASTLTASQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4orf16 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV813957 1.0 µg DNA

C4orf16 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Lipoprotein signal peptidase (lspA)
MBS7019489-01 0.02 mg

Recombinant Salmonella heidelberg Lipoprotein signal peptidase (lspA)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Lipoprotein signal peptidase (lspA)
MBS7019489-02 0.1 mg

Recombinant Salmonella heidelberg Lipoprotein signal peptidase (lspA)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Lipoprotein signal peptidase (lspA)
MBS7019489-03 5x 0.1 mg

Recombinant Salmonella heidelberg Lipoprotein signal peptidase (lspA)

Sign In for Pricing
View Details
Bak (A2) polyclonal antibody
orb642540-01 25 µL

Bak (A2) polyclonal antibody

Sign In for Pricing
View Details
Bak (A2) polyclonal antibody
orb642540-02 50 μL

Bak (A2) polyclonal antibody

Sign In for Pricing
View Details