Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRE5 Peptide - C-terminal region

ADGRE5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD97, TM7LN1

UniProt

P48960

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADGRE5 Rabbit Polyclonal Antibody (orb585747) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020331

Preservative

Lyophilized powder

AA Sequence

NSIFLSHNNTKELNSPILFAFSHLESSDGEAGRDPPAKDVMPGPRQELLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salmonella typhi Protein nrdI (nrdI)
MBS1362382-01 0.02 mg (E-Coli)

Recombinant Salmonella typhi Protein nrdI (nrdI)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Protein nrdI (nrdI)
MBS1362382-02 0.1 mg (E-Coli)

Recombinant Salmonella typhi Protein nrdI (nrdI)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Protein nrdI (nrdI)
MBS1362382-03 0.02 mg (Yeast)

Recombinant Salmonella typhi Protein nrdI (nrdI)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Protein nrdI (nrdI)
MBS1362382-04 0.1 mg (Yeast)

Recombinant Salmonella typhi Protein nrdI (nrdI)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Protein nrdI (nrdI)
MBS1362382-05 0.02 mg (Baculovirus)

Recombinant Salmonella typhi Protein nrdI (nrdI)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Protein nrdI (nrdI)
MBS1362382-06 0.02 mg (Mammalian-Cell)

Recombinant Salmonella typhi Protein nrdI (nrdI)

Sign In for Pricing
View Details