Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRE5 Peptide - C-terminal region

ADGRE5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD97, TM7LN1

UniProt

P48960

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADGRE5 Rabbit Polyclonal Antibody (orb585747) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020331

Preservative

Lyophilized powder

AA Sequence

NSIFLSHNNTKELNSPILFAFSHLESSDGEAGRDPPAKDVMPGPRQELLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat rno-miR-378b miRNA Agomir
abx885178-01 5 nmol

Rat rno-miR-378b miRNA Agomir

Sign In for Pricing
View Details
Rat rno-miR-378b miRNA Agomir
abx885178-02 10 nmol

Rat rno-miR-378b miRNA Agomir

Sign In for Pricing
View Details
ING5 Antibody, Biotin conjugated
CSB-PA820185LD01HU-01 50 µg

ING5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ING5 Antibody, Biotin conjugated
CSB-PA820185LD01HU-02 100 µg

ING5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Plastin Double Nickase Plasmid (h)
sc-402979-NIC 20 µg

Plastin Double Nickase Plasmid (h)

Sign In for Pricing
View Details
DARC Rabbit mAb Antibody
orb1727221-01 50 µL

DARC Rabbit mAb Antibody

Sign In for Pricing
View Details