Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLAU Peptide - C-terminal region

PLAU Peptide - C-terminal region

Product Specifications

Product Name Alternative

ATF, UPA, URK, u-PA, QPD, BDPLT5

UniProt

P00749

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLAU Rabbit Polyclonal Antibody (orb585748) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002649

Preservative

Lyophilized powder

AA Sequence

CSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF454 Mouse Monoclonal Antibody [Clone ID: OTI7C4]
CF811041 100 µg

ZNF454 Mouse Monoclonal Antibody [Clone ID: OTI7C4]

Sign In for Pricing
View Details
LRRIQ1 Human Gene Knockout Kit (CRISPR)
KN423955 1 Kit

LRRIQ1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Nuclear Factor Of Activated T-Cells, Cytoplasmic 2 (NFATC2) ELISA Kit
RDR-NFATC2-Hu-01 96 Tests

Human Nuclear Factor Of Activated T-Cells, Cytoplasmic 2 (NFATC2) ELISA Kit

Sign In for Pricing
View Details
Human Nuclear Factor Of Activated T-Cells, Cytoplasmic 2 (NFATC2) ELISA Kit
RDR-NFATC2-Hu-02 48 Tests

Human Nuclear Factor Of Activated T-Cells, Cytoplasmic 2 (NFATC2) ELISA Kit

Sign In for Pricing
View Details
Involucrin (SY5), CF568 conjugate, 0.1mg/mL
BNC680678-100 1x 100 µL

Involucrin (SY5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zbed4 Mouse Gene Knockout Kit (CRISPR)
KN519586 1 Kit

Zbed4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details