RAB11A Peptide - C-terminal region
RAB11A Peptide - C-terminal region
Product Specifications
Product Name Alternative
MGC1490, YL8
UniProt
P62491
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RAB11A Rabbit Polyclonal Antibody (orb585750) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004654
Preservative
Lyophilized powder
AA Sequence
NVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC883081-100 1x 100 µL
Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3081), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP51492PU-N 400 µL
Factor XI (F11) (Center) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNC402958-500 1x 500 µL
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-A619500-50MG 50 mg
N-(5-Aminopentyl)-5-chloro-2-naphthalenesulfonamide Hydrochloride
Sign In for Pricing
View Details