RAB11A Peptide - C-terminal region
RAB11A Peptide - C-terminal region
Product Specifications
Product Name Alternative
MGC1490, YL8
UniProt
P62491
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RAB11A Rabbit Polyclonal Antibody (orb585750) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004654
Preservative
Lyophilized powder
AA Sequence
NVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Calnexin Recombinant Rabbit Monoclonal Antibody [SN20-54]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea826c0/imageurl/et1611-86.webp)
ET1611-86 100 µL
Calnexin Recombinant Rabbit Monoclonal Antibody [SN20-54]
Sign In for Pricing
View Details 
BNC680984-500 1x 500 µL
P21 / WAF1 (HJ21), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC402059 20 µg
Retinoid X Receptor gamma (RXRG) (NM_006917) Human Over-expression Lysate
Sign In for Pricing
View Details 