Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF280B Peptide - N-terminal region

ZNF280B Peptide - N-terminal region

Product Specifications

Product Name Alternative

5'OY11.1, D87009.C22.3, SUHW2, ZNF279, ZNF632

UniProt

Q86YH2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF280B Rabbit Polyclonal Antibody (orb574096) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542942

Preservative

Lyophilized powder

AA Sequence

EEEKEPEPQKNIQETKQVDDEDAELIFVGVEHVNEDAELIFVGVTSNSKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nano Spectrophotometer BSNA-201
BSNA-201 1 Unit

Nano Spectrophotometer BSNA-201

Sign In for Pricing
View Details
HDAC11 (NM_001136041) Human Over-expression Lysate
LC427788 20 µg

HDAC11 (NM_001136041) Human Over-expression Lysate

Sign In for Pricing
View Details
CBFB Polyclonal Antibody
E-AB-52520-01 20 µL

CBFB Polyclonal Antibody

Sign In for Pricing
View Details
CBFB Polyclonal Antibody
E-AB-52520-02 60 µL

CBFB Polyclonal Antibody

Sign In for Pricing
View Details
CBFB Polyclonal Antibody
E-AB-52520-03 120 µL

CBFB Polyclonal Antibody

Sign In for Pricing
View Details
CBFB Polyclonal Antibody
E-AB-52520-04 200 µL

CBFB Polyclonal Antibody

Sign In for Pricing
View Details