Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF280B Peptide - N-terminal region

ZNF280B Peptide - N-terminal region

Product Specifications

Product Name Alternative

5'OY11.1, D87009.C22.3, SUHW2, ZNF279, ZNF632

UniProt

Q86YH2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF280B Rabbit Polyclonal Antibody (orb574096) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542942

Preservative

Lyophilized powder

AA Sequence

EEEKEPEPQKNIQETKQVDDEDAELIFVGVEHVNEDAELIFVGVTSNSKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CXCR3 activation kit by CRISPRa
GA101898 1 Kit

Human CXCR3 activation kit by CRISPRa

Sign In for Pricing
View Details
Try10 Mouse Gene Knockout Kit (CRISPR)
KN518316 1 Kit

Try10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KAD-1229-d8 Calcium Hydrate
TRC-K090002-1MG 1 mg

KAD-1229-d8 Calcium Hydrate

Sign In for Pricing
View Details
Temgicoluril-d12
TRC-T367781-5MG 5 mg

Temgicoluril-d12

Sign In for Pricing
View Details
Asoxime Dimesylate
TRC-A820485-100MG 100 mg

Asoxime Dimesylate

Sign In for Pricing
View Details
Btf3 Mouse Gene Knockout Kit (CRISPR)
KN502304 1 Kit

Btf3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details