Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSX5 Peptide - C-terminal region

SSX5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC9494

UniProt

O60225

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SSX5 Rabbit Polyclonal Antibody (orb577136) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_783729

Preservative

Lyophilized powder

AA Sequence

EGNDSKGVPEASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Swine IgG,  30nm
GAF-471-30 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Swine IgG, 30nm

Sign In for Pricing
View Details
AMBRA1 Human Gene Knockout Kit (CRISPR)
KN206255BN 1 Kit

AMBRA1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
n-Docosanal
TRC-D678865-500MG 500 mg

n-Docosanal

Sign In for Pricing
View Details
Uncoated Human CEACAM1 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 1) ELISA Kit
E-UNEL-H0260-01 5x 96 Tests

Uncoated Human CEACAM1 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human CEACAM1 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 1) ELISA Kit
E-UNEL-H0260-02 15x 96 Tests

Uncoated Human CEACAM1 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 1) ELISA Kit

Sign In for Pricing
View Details
CYP2W1 Polyclonal Antibody
E-AB-11119-01 20 µL

CYP2W1 Polyclonal Antibody

Sign In for Pricing
View Details