Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSX5 Peptide - C-terminal region

SSX5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC9494

UniProt

O60225

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SSX5 Rabbit Polyclonal Antibody (orb577136) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_783729

Preservative

Lyophilized powder

AA Sequence

EGNDSKGVPEASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD32b/FCGR2B Protein (CHO Cells, His Tag)
PKSH031727-01 100 µg

Recombinant Human CD32b/FCGR2B Protein (CHO Cells, His Tag)

Sign In for Pricing
View Details
Recombinant Human CD32b/FCGR2B Protein (CHO Cells, His Tag)
PKSH031727-02 1 mg

Recombinant Human CD32b/FCGR2B Protein (CHO Cells, His Tag)

Sign In for Pricing
View Details
4-Amino-3-Hydroxybutanoic Acid
TRC-A611270-50G 50 g

4-Amino-3-Hydroxybutanoic Acid

Sign In for Pricing
View Details
Human IL-13 Recombinant Rabbit monoclonal Antibody
HA725013 100 µL

Human IL-13 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CPEB4 Human Gene Knockout Kit (CRISPR)
KN421803 1 Kit

CPEB4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARHGEF6 (C-term) Rabbit Polyclonal Antibody
AP50239PU-N 400 µL

ARHGEF6 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details