Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R3B Peptide - N-terminal region

PPP2R3B Peptide - N-terminal region

Product Specifications

Product Name Alternative

NY-REN-8, PPP2R3L, PPP2R3LY, PR48, NYREN8

UniProt

Q9Y5P8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP2R3B Rabbit Polyclonal Antibody (orb578449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037371

Preservative

Lyophilized powder

AA Sequence

APHVRGTRRSAGTRVVQTRKEEPLPPATSQSIPTFYFPRGRPQDSVNVDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJA1P4 AAV Vector (Human) (CMV)
18369101 1 µg

DNAJA1P4 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
GPR6 cDNA Clone
MBS1269612-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

GPR6 cDNA Clone

Sign In for Pricing
View Details
GPR6 cDNA Clone
MBS1269612-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

GPR6 cDNA Clone

Sign In for Pricing
View Details
Recombinant Mycobacterium leprae Acetolactate synthase small subunit (ilvH)
MBS1005784-01 0.02 mg (E-Coli)

Recombinant Mycobacterium leprae Acetolactate synthase small subunit (ilvH)

Sign In for Pricing
View Details
Recombinant Mycobacterium leprae Acetolactate synthase small subunit (ilvH)
MBS1005784-02 0.1 mg (E-Coli)

Recombinant Mycobacterium leprae Acetolactate synthase small subunit (ilvH)

Sign In for Pricing
View Details
Recombinant Mycobacterium leprae Acetolactate synthase small subunit (ilvH)
MBS1005784-03 0.02 mg (Yeast)

Recombinant Mycobacterium leprae Acetolactate synthase small subunit (ilvH)

Sign In for Pricing
View Details