Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mfsd11 Peptide - C-terminal region

Mfsd11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2600014M03Rik, MGC113819

UniProt

Q8BJ51

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mfsd11 Rabbit Polyclonal Antibody (orb580878) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848735

Preservative

Lyophilized powder

AA Sequence

CSFLLGLGDSCFNTQLLSILGFLYSEDSAPAFAVFKFVQSICAAVAFFYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAGE8 Human shRNA Plasmid Kit (Locus ID 100101629)
TR321433 1 Kit

GAGE8 Human shRNA Plasmid Kit (Locus ID 100101629)

Sign In for Pricing
View Details
Bovine Neurotrophin-2 ELISA Kit
MBS743531-01 48 Well

Bovine Neurotrophin-2 ELISA Kit

Sign In for Pricing
View Details
Bovine Neurotrophin-2 ELISA Kit
MBS743531-02 96 Well

Bovine Neurotrophin-2 ELISA Kit

Sign In for Pricing
View Details
Bovine Neurotrophin-2 ELISA Kit
MBS743531-03 5x 96 Well

Bovine Neurotrophin-2 ELISA Kit

Sign In for Pricing
View Details
Bovine Neurotrophin-2 ELISA Kit
MBS743531-04 10x 96 Well

Bovine Neurotrophin-2 ELISA Kit

Sign In for Pricing
View Details
Anti-CD18 (Azide-Free) Antibody
MBS4158807-01 0.1 mg

Anti-CD18 (Azide-Free) Antibody

Sign In for Pricing
View Details