Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mfsd11 Peptide - C-terminal region

Mfsd11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2600014M03Rik, MGC113819

UniProt

Q8BJ51

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mfsd11 Rabbit Polyclonal Antibody (orb580878) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848735

Preservative

Lyophilized powder

AA Sequence

CSFLLGLGDSCFNTQLLSILGFLYSEDSAPAFAVFKFVQSICAAVAFFYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MOSPD1 Antibody [DyLight 405]
NBP2-81739V 0.1 mL

Rabbit Polyclonal MOSPD1 Antibody [DyLight 405]

Sign In for Pricing
View Details
IQUB (NM_178827) Human Over-expression Lysate
LY405844 100 µg

IQUB (NM_178827) Human Over-expression Lysate

Sign In for Pricing
View Details
Cp-set siRNA/shRNA/RNAi Lentivector (Mouse)
16730094 4x 500 ng

Cp-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Myosin Heavy Chain 7, Cardiac Muscle, Beta (MYH7)
MBS2109993-01 0.1 mL

HRP-Linked Polyclonal Antibody to Myosin Heavy Chain 7, Cardiac Muscle, Beta (MYH7)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Myosin Heavy Chain 7, Cardiac Muscle, Beta (MYH7)
MBS2109993-02 0.2 mL

HRP-Linked Polyclonal Antibody to Myosin Heavy Chain 7, Cardiac Muscle, Beta (MYH7)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Myosin Heavy Chain 7, Cardiac Muscle, Beta (MYH7)
MBS2109993-03 0.5 mL

HRP-Linked Polyclonal Antibody to Myosin Heavy Chain 7, Cardiac Muscle, Beta (MYH7)

Sign In for Pricing
View Details