Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pigu Peptide - N-terminal region

Pigu Peptide - N-terminal region

Product Specifications

Product Name Alternative

5430426F17Rik, BC028278, Cdc91l1

UniProt

Q3TAA8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pigu Rabbit Polyclonal Antibody (orb325567) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004721

Preservative

Lyophilized powder

AA Sequence

PLALVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLALLDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 Spike RBD (K417T) (rFc Tag)
PKSV030380 100 µg

Recombinant SARS-CoV-2 Spike RBD (K417T) (rFc Tag)

Sign In for Pricing
View Details
MTHFD1 Rabbit Polyclonal Antibody
TA361275 100 µL

MTHFD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elk1 (Ab-417) Antibody
8B7070-AAT 50 µg

Elk1 (Ab-417) Antibody

Sign In for Pricing
View Details
STAT3 / Signal Transducer and Activator of Transcription 3 (PCRP-STAT3-2F12), CF647 conjugate, 0.1mg/mL
BNC471907-500 1x 500 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (PCRP-STAT3-2F12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
c-Jun (JUN) pThr91 Rabbit Polyclonal Antibody
AP02322PU-S 50 µL

c-Jun (JUN) pThr91 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Chlorobenzamide
TRC-C364688-500MG 500 mg

4-Chlorobenzamide

Sign In for Pricing
View Details