Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pigu Peptide - N-terminal region

Pigu Peptide - N-terminal region

Product Specifications

Product Name Alternative

5430426F17Rik, BC028278, Cdc91l1

UniProt

Q3TAA8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pigu Rabbit Polyclonal Antibody (orb325567) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004721

Preservative

Lyophilized powder

AA Sequence

PLALVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLALLDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), 0.2mg/mL
BNUB2044-500 1x 500 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), 0.2mg/mL

Sign In for Pricing
View Details
RNASE9 (NM_001110356) Human Over-expression Lysate
LC426320 20 µg

RNASE9 (NM_001110356) Human Over-expression Lysate

Sign In for Pricing
View Details
MACROH2A1 Antibody
KC-2486-01 50 μL

MACROH2A1 Antibody

Sign In for Pricing
View Details
MACROH2A1 Antibody
KC-2486-02 100 µL

MACROH2A1 Antibody

Sign In for Pricing
View Details
MACROH2A1 Antibody
KC-2486-03 1 mL

MACROH2A1 Antibody

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), Biotin conjugate, 0.1mg/mL
BNCB0637-500 1x 500 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details