Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APH1B Peptide - C-terminal region

APH1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

APH-1B, DKFZp564D0372, FLJ33115, PRO1328, PSFL, TAAV688

UniProt

Q564N3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APH1B Rabbit Polyclonal Antibody (orb325899) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139118

Preservative

Lyophilized powder

AA Sequence

YYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Platelet Membrane Glycoprotein 2B3A/Cd41+Cd61 ELISA Kit
MBS010455 Inquire

Cavy Platelet Membrane Glycoprotein 2B3A/Cd41+Cd61 ELISA Kit

Sign In for Pricing
View Details
ZHX2 Polyclonal Conjugated Antibody
orb1626722 100 µL

ZHX2 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Goat Anti-Mouse IgG2a, Human ads-TRITC
MBS674472-01 1 mg

Goat Anti-Mouse IgG2a, Human ads-TRITC

Sign In for Pricing
View Details
Goat Anti-Mouse IgG2a, Human ads-TRITC
MBS674472-02 5x 1 mg

Goat Anti-Mouse IgG2a, Human ads-TRITC

Sign In for Pricing
View Details
OAS3 Protein Vector (Human) (pPB-N-His)
PV055738 500 ng

OAS3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Geobacter sulfurreducens Large-conductance mechanosensitive channel (mscL), partial
MBS7088765 Inquire

Recombinant Geobacter sulfurreducens Large-conductance mechanosensitive channel (mscL), partial

Sign In for Pricing
View Details