Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APH1B Peptide - C-terminal region

APH1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

APH-1B, DKFZp564D0372, FLJ33115, PRO1328, PSFL, TAAV688

UniProt

Q564N3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APH1B Rabbit Polyclonal Antibody (orb325899) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139118

Preservative

Lyophilized powder

AA Sequence

YYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Dazzle™ 594 anti-mouse/rat XCR1
GT05049 25 µg

PE/Dazzle™ 594 anti-mouse/rat XCR1

Sign In for Pricing
View Details
Rat Eotaxin 1 (CCL11) ELISA Kit
AE62880RA-01 48 Tests

Rat Eotaxin 1 (CCL11) ELISA Kit

Sign In for Pricing
View Details
Rat Eotaxin 1 (CCL11) ELISA Kit
AE62880RA-02 96 Tests

Rat Eotaxin 1 (CCL11) ELISA Kit

Sign In for Pricing
View Details
Anserini CTx1 ELISA Kit
EAC0242 96 Tests

Anserini CTx1 ELISA Kit

Sign In for Pricing
View Details
Eif4e Antibody
GWB-MV426C 50 µg

Eif4e Antibody

Sign In for Pricing
View Details
Hamster Pyruvate Kinase, Liver and Rbc ELISA Kit
MBS034216-01 48 Well

Hamster Pyruvate Kinase, Liver and Rbc ELISA Kit

Sign In for Pricing
View Details