Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Necab1 Peptide - C-terminal region

Necab1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1700003H21Rik, Efcbp1, STIP-1

UniProt

Q8BG18

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Necab1 Rabbit Polyclonal Antibody (orb583644) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848732

Preservative

Lyophilized powder

AA Sequence

HIMLVQRQMSVTEEDLEEFQLALKHYVESASAQSGCLRISIQKLSNESRY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF800-set siRNA/shRNA/RNAi Lentivector (Human)
51848091 4x 500 ng

ZNF800-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
COMMD2 Antibody; FITC conjugated
MBS7004648-01 0.05 mg

COMMD2 Antibody; FITC conjugated

Sign In for Pricing
View Details
COMMD2 Antibody; FITC conjugated
MBS7004648-02 0.1 mg

COMMD2 Antibody; FITC conjugated

Sign In for Pricing
View Details
COMMD2 Antibody; FITC conjugated
MBS7004648-03 5x 0.1 mg

COMMD2 Antibody; FITC conjugated

Sign In for Pricing
View Details
SPTLC2 Antibody (Center)
orb166698-01 50 µL

SPTLC2 Antibody (Center)

Sign In for Pricing
View Details
SPTLC2 Antibody (Center)
orb166698-02 100 µL

SPTLC2 Antibody (Center)

Sign In for Pricing
View Details