Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Necab1 Peptide - C-terminal region

Necab1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1700003H21Rik, Efcbp1, STIP-1

UniProt

Q8BG18

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Necab1 Rabbit Polyclonal Antibody (orb583644) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848732

Preservative

Lyophilized powder

AA Sequence

HIMLVQRQMSVTEEDLEEFQLALKHYVESASAQSGCLRISIQKLSNESRY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPRIN2 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2385231 100 µL

GPRIN2 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Human Cluster Of Differentiation 86 (CD86) ELISA Kit
EKU02727 96 Tests

Human Cluster Of Differentiation 86 (CD86) ELISA Kit

Sign In for Pricing
View Details
ZNF592 Blocking Peptide
MBS9624800-01 1 mg

ZNF592 Blocking Peptide

Sign In for Pricing
View Details
ZNF592 Blocking Peptide
MBS9624800-02 5x 1 mg

ZNF592 Blocking Peptide

Sign In for Pricing
View Details
pBluescriptR-SDSL Plasmid
PVT14661 2 µg

pBluescriptR-SDSL Plasmid

Sign In for Pricing
View Details
Comfort MTP (HxD) 5x6=30 plates 65mm, 336x540x135mm
TE35556 1 Piece

Comfort MTP (HxD) 5x6=30 plates 65mm, 336x540x135mm

Sign In for Pricing
View Details