Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Necab1 Peptide - C-terminal region

Necab1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1700003H21Rik, Efcbp1, STIP-1

UniProt

Q8BG18

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Necab1 Rabbit Polyclonal Antibody (orb583644) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848732

Preservative

Lyophilized powder

AA Sequence

HIMLVQRQMSVTEEDLEEFQLALKHYVESASAQSGCLRISIQKLSNESRY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,5-Dimethyl-1,4-dihydroquinolin-4-one
CCA48190-01 50 mg

2,5-Dimethyl-1,4-dihydroquinolin-4-one

Sign In for Pricing
View Details
2,5-Dimethyl-1,4-dihydroquinolin-4-one
CCA48190-02 0.5 g

2,5-Dimethyl-1,4-dihydroquinolin-4-one

Sign In for Pricing
View Details
Anti-TIAM2 Rabbit Monoclonal Antibody
MA5430-.05 50 µL

Anti-TIAM2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MSX1, ID (MSX1, HOX7, Homeobox protein MSX-1, Homeobox protein Hox-7, Msh homeobox 1-like protein) (Biotin) discontinued
038644-Biotin 200 µL

MSX1, ID (MSX1, HOX7, Homeobox protein MSX-1, Homeobox protein Hox-7, Msh homeobox 1-like protein) (Biotin) discontinued

Sign In for Pricing
View Details
DPCR1 shRNA (m) Lentiviral Particles
sc-143151-V 200 µL

DPCR1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
RNY4P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV746966 1.0 µg DNA

RNY4P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details