Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppp4r4 Peptide - C-terminal region

Ppp4r4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

8430415E04Rik, mKIAA1622

UniProt

Q8C0Y0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ppp4r4 Rabbit Polyclonal Antibody (orb583678) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_083256

Preservative

Lyophilized powder

AA Sequence

VKKTVLELDRMEMSMDMFQKKNYEKDLLDQEKEREELLFLEMEQLEKEKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF3C5 (NM_001286709) Human Tagged ORF Clone
RG237607 10 µg

GTF3C5 (NM_001286709) Human Tagged ORF Clone

Sign In for Pricing
View Details
Bid Mouse Gene Knockout Kit (CRISPR)
KN502166 1 Kit

Bid Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prolactin Receptor (B6.2 + PRLR742), CF740 conjugate, 0.1mg/mL
BNC740744-100 1x 100 µL

Prolactin Receptor (B6.2 + PRLR742), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXA1 / HNF3A (FOXA1/2230R), CF488A conjugate, 0.1mg/mL
BNC882230-500 1x 500 µL

FOXA1 / HNF3A (FOXA1/2230R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alkaline Protease Microplate Assay Kit
RDSM079 100 Assays

Alkaline Protease Microplate Assay Kit

Sign In for Pricing
View Details
Recombinant BAT3 Antibody
RC-4398-01 50 μL

Recombinant BAT3 Antibody

Sign In for Pricing
View Details