Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppp4r4 Peptide - C-terminal region

Ppp4r4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

8430415E04Rik, mKIAA1622

UniProt

Q8C0Y0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ppp4r4 Rabbit Polyclonal Antibody (orb583678) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_083256

Preservative

Lyophilized powder

AA Sequence

VKKTVLELDRMEMSMDMFQKKNYEKDLLDQEKEREELLFLEMEQLEKEKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myelin PLP Recombinant Rabbit monoclonal Antibody
HA751212 100 µL

Myelin PLP Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD79a (JCB117), 1mg/mL
BNUM0476-50 1x 50 µL

CD79a (JCB117), 1mg/mL

Sign In for Pricing
View Details
2-Isopropoxyethanol
TRC-I918253-25ML 25 mL

2-Isopropoxyethanol

Sign In for Pricing
View Details
Recombinant Human KIAA0101/p15/PAF Protein (His Tag)
PKSH031315 50 µg

Recombinant Human KIAA0101/p15/PAF Protein (His Tag)

Sign In for Pricing
View Details
5-Chloroindole-2-carboxylic Acid
TRC-C377710-25G 25 g

5-Chloroindole-2-carboxylic Acid

Sign In for Pricing
View Details
PAXIP1-DT Human qPCR Primer Pair (XM_117455)
HP221134 200 Reactions

PAXIP1-DT Human qPCR Primer Pair (XM_117455)

Sign In for Pricing
View Details