Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fam170b Peptide - middle region

Fam170b Peptide - middle region

Product Specifications

Product Name Alternative

4922501K12Rik, AI449756

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fam170b Rabbit Polyclonal Antibody (orb583721) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157957

Preservative

Lyophilized powder

AA Sequence

QQPVEEEQSLSDSSECTRLLTKVLPWQQQPQQQPQEQQKQQQQQQQKQRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smg7 Mouse Gene Knockout Kit (CRISPR)
KN516313 1 Kit

Smg7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APC Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189UE-01 25 µg

APC Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details
APC Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189UE-02 100 µg

APC Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS807840 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: rectosigmoid
CS629952 5x 5 µm

Frozen Tissue Sections, Colon: rectosigmoid

Sign In for Pricing
View Details
Recombinant Human CXCL13 protein (His Tag)
PKSH034197-01 20 µg

Recombinant Human CXCL13 protein (His Tag)

Sign In for Pricing
View Details