Fam170b Peptide - middle region
Fam170b Peptide - middle region
Product Specifications
Product Name Alternative
4922501K12Rik, AI449756
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Fam170b Rabbit Polyclonal Antibody (orb583721) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001157957
Preservative
Lyophilized powder
AA Sequence
QQPVEEEQSLSDSSECTRLLTKVLPWQQQPQQQPQEQQKQQQQQQQKQRQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Cyanine 3.5 monosuccinimidyl ester, potassium salt [same as GE Cy3.5® NHS ester]](https://cdn.genprice.uk/products/271/7358566/imageurl/275-aat.webp)
275-AAT 1 mg
Cyanine 3.5 monosuccinimidyl ester, potassium salt [same as GE Cy3.5® NHS ester]
Sign In for Pricing
View Details 
KN203222BN 1 Kit
CalreticULin (CALR) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
ICH1077-5mg 5 mg
Anti-Mouse CD209b (22D1) In Vivo Antibody - Low Endotoxin
Sign In for Pricing
View Details 