Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Numb Peptide - C-terminal region

Numb Peptide - C-terminal region

Product Specifications

Product Name Alternative

M-numb, mnb, m-Nb

UniProt

Q9QZS3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Numb Rabbit Polyclonal Antibody (orb331043) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_035079

Preservative

Lyophilized powder

AA Sequence

ASGNRHAEVPPGTCPVDPFEAQWAALESKSKQRTNPSPTNPFSSDLQKTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA5 Antibody
orb1264344 400 μl

HSPA5 Antibody

Sign In for Pricing
View Details
Armadillo Repeat Containing, X-Linked 6 (ARMCX6) Antibody (HRP)
abx308172-01 20 µg

Armadillo Repeat Containing, X-Linked 6 (ARMCX6) Antibody (HRP)

Sign In for Pricing
View Details
Armadillo Repeat Containing, X-Linked 6 (ARMCX6) Antibody (HRP)
abx308172-02 50 µg

Armadillo Repeat Containing, X-Linked 6 (ARMCX6) Antibody (HRP)

Sign In for Pricing
View Details
Armadillo Repeat Containing, X-Linked 6 (ARMCX6) Antibody (HRP)
abx308172-03 100 µg

Armadillo Repeat Containing, X-Linked 6 (ARMCX6) Antibody (HRP)

Sign In for Pricing
View Details
Armadillo Repeat Containing, X-Linked 6 (ARMCX6) Antibody (HRP)
abx308172-04 200 µg

Armadillo Repeat Containing, X-Linked 6 (ARMCX6) Antibody (HRP)

Sign In for Pricing
View Details
Armadillo Repeat Containing, X-Linked 6 (ARMCX6) Antibody (HRP)
abx308172-05 1 mg

Armadillo Repeat Containing, X-Linked 6 (ARMCX6) Antibody (HRP)

Sign In for Pricing
View Details