Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Numb Peptide - C-terminal region

Numb Peptide - C-terminal region

Product Specifications

Product Name Alternative

M-numb, mnb, m-Nb

UniProt

Q9QZS3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Numb Rabbit Polyclonal Antibody (orb331043) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_035079

Preservative

Lyophilized powder

AA Sequence

ASGNRHAEVPPGTCPVDPFEAQWAALESKSKQRTNPSPTNPFSSDLQKTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human AIMP1 Protein [His]
VAng-2918Lsx-200g 200 µg

Recombinant Human AIMP1 Protein [His]

Sign In for Pricing
View Details
Duox1 (NM_153739) Rat Untagged Clone
RN203031 10 µg

Duox1 (NM_153739) Rat Untagged Clone

Sign In for Pricing
View Details
Recombinant Mycobacterium Vanbaalenii prcA Protein (aa 1-254)
VAng-Yyj5099-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Vanbaalenii prcA Protein (aa 1-254)

Sign In for Pricing
View Details
Mouse Monoclonal BarX1 Antibody (BARX1/2760) [DyLight 755]
NBP3-08671IR 100 µL

Mouse Monoclonal BarX1 Antibody (BARX1/2760) [DyLight 755]

Sign In for Pricing
View Details
DGK-epsilon Recombinant Protein Antigen
NBP1-85315PEP 0.1 mL

DGK-epsilon Recombinant Protein Antigen

Sign In for Pricing
View Details
Recombinant Human CD167a/DDR1 Protein, C-His
orb2834253-01 20 µg

Recombinant Human CD167a/DDR1 Protein, C-His

Sign In for Pricing
View Details