Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stx1a Peptide - N-terminal region

Stx1a Peptide - N-terminal region

Product Specifications

Product Name Alternative

HPC-1

UniProt

O35526

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Stx1a Rabbit Polyclonal Antibody (orb584352) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058081

Preservative

Lyophilized powder

AA Sequence

EFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome p450 (M12P4H2), Biotin conjugate, 0.1mg/mL
BNCB2199-100 1x 100 µL

Cytochrome p450 (M12P4H2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CNTN6 activation kit by CRISPRa
GA109090 1 Kit

Human CNTN6 activation kit by CRISPRa

Sign In for Pricing
View Details
3Beta-Acetoxyandrost-5-en-17-one Acetylhydrazone
TRC-A164315-5G 5 g

3Beta-Acetoxyandrost-5-en-17-one Acetylhydrazone

Sign In for Pricing
View Details
CFC1 Rabbit Polyclonal Antibody
TA367423 100 µL

CFC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H3.3 (Ab-31) Antibody
8B0792-AAT 50 µg

Histone H3.3 (Ab-31) Antibody

Sign In for Pricing
View Details
P55;50 EBV-Early Antigen (1108-1), CF647 conjugate, 0.1mg/mL
BNC470103-500 1x 500 µL

P55;50 EBV-Early Antigen (1108-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details