Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stx2 Peptide - middle region

Stx2 Peptide - middle region

Product Specifications

Product Name Alternative

AW538950, Epim, G1-536-1, MGC54718, Syn-2, repro34

UniProt

Q00262

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Stx2 Rabbit Polyclonal Antibody (orb584367) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031967

Preservative

Lyophilized powder

AA Sequence

RQLEITGRTTTDDELEEMLESGKPSIFISDIISDSQITRQALNEIESRHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSLN Antibody
orb2623951 100 µL

MSLN Antibody

Sign In for Pricing
View Details
General Aldosterone (ALD) ELISA Kit
MBS457528-01 48 Tests

General Aldosterone (ALD) ELISA Kit

Sign In for Pricing
View Details
General Aldosterone (ALD) ELISA Kit
MBS457528-02 96 Tests

General Aldosterone (ALD) ELISA Kit

Sign In for Pricing
View Details
General Aldosterone (ALD) ELISA Kit
MBS457528-03 5x 96 Tests

General Aldosterone (ALD) ELISA Kit

Sign In for Pricing
View Details
General Aldosterone (ALD) ELISA Kit
MBS457528-04 10x 96 Tests

General Aldosterone (ALD) ELISA Kit

Sign In for Pricing
View Details
IL23R polyclonal antibody
orb1787443-01 50 µL

IL23R polyclonal antibody

Sign In for Pricing
View Details