Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stx2 Peptide - middle region

Stx2 Peptide - middle region

Product Specifications

Product Name Alternative

AW538950, Epim, G1-536-1, MGC54718, Syn-2, repro34

UniProt

Q00262

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Stx2 Rabbit Polyclonal Antibody (orb584367) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031967

Preservative

Lyophilized powder

AA Sequence

RQLEITGRTTTDDELEEMLESGKPSIFISDIISDSQITRQALNEIESRHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGF2BP3 Polyclonal Antibody
E-AB-62356-01 60 µL

IGF2BP3 Polyclonal Antibody

Sign In for Pricing
View Details
IGF2BP3 Polyclonal Antibody
E-AB-62356-02 120 µL

IGF2BP3 Polyclonal Antibody

Sign In for Pricing
View Details
IGF2BP3 Polyclonal Antibody
E-AB-62356-03 200 µL

IGF2BP3 Polyclonal Antibody

Sign In for Pricing
View Details
Z-DNA (poly dG-dC, Left Handed DNA) (MaxLight 405) discontinued discontinued
Z0400-ML405 100 µL

Z-DNA (poly dG-dC, Left Handed DNA) (MaxLight 405) discontinued discontinued

Sign In for Pricing
View Details
Recombinant Human IFNA1/Interferon alpha-D Protein, GST
orb2966460-01 50 µg

Recombinant Human IFNA1/Interferon alpha-D Protein, GST

Sign In for Pricing
View Details
Recombinant Human IFNA1/Interferon alpha-D Protein, GST
orb2966460-02 100 µg

Recombinant Human IFNA1/Interferon alpha-D Protein, GST

Sign In for Pricing
View Details