Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnls Peptide - middle region

Rnls Peptide - middle region

Product Specifications

Product Name Alternative

6530404N21Rik, AI452315, AW060440, C10orf59

UniProt

A7RDN6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rnls Rabbit Polyclonal Antibody (orb331056) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001161290

Preservative

Lyophilized powder

AA Sequence

GMKIGVPWSCRYLSSHPCICFISIDNKKRNIESSECGPSVVIQTTVPFGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSMR Protein Lysate (Human) with C-Ha Tag
35769032 100 µg

OSMR Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
PRPSAP1 (Phosphoribosyl Pyrophosphate Synthase-associated Protein 1, PAP39) (MaxLight 405)
MBS6433387-01 0.1 mL

PRPSAP1 (Phosphoribosyl Pyrophosphate Synthase-associated Protein 1, PAP39) (MaxLight 405)

Sign In for Pricing
View Details
PRPSAP1 (Phosphoribosyl Pyrophosphate Synthase-associated Protein 1, PAP39) (MaxLight 405)
MBS6433387-02 5x 0.1 mL

PRPSAP1 (Phosphoribosyl Pyrophosphate Synthase-associated Protein 1, PAP39) (MaxLight 405)

Sign In for Pricing
View Details
Inositol 1,4,5-triphosphate Receptor-interacting protein-Like 1 (ITPRIPL1) Mouse ELISA Kit
E2707 96 Tests

Inositol 1,4,5-triphosphate Receptor-interacting protein-Like 1 (ITPRIPL1) Mouse ELISA Kit

Sign In for Pricing
View Details
PRAP1 Lentiviral Activation Particles (m2)
sc-423619-LAC-2 200 µL

PRAP1 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Human Fatty Acid-Binding Protein 7 (FABP7) AssayLite™ Antibody (FITC Conjugate)
30018-05141 2x 75 µg

Human Fatty Acid-Binding Protein 7 (FABP7) AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details