Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnls Peptide - middle region

Rnls Peptide - middle region

Product Specifications

Product Name Alternative

6530404N21Rik, AI452315, AW060440, C10orf59

UniProt

A7RDN6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rnls Rabbit Polyclonal Antibody (orb331056) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001161290

Preservative

Lyophilized powder

AA Sequence

GMKIGVPWSCRYLSSHPCICFISIDNKKRNIESSECGPSVVIQTTVPFGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLGLB1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1668805 3x 1.0 µg

PLGLB1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Epdr1 AAV siRNA Pooled Vector
19350166 1.0 µg

Epdr1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Hypothetical membrane spanning protein (CBU_1863), partial
CSB-EP4560DXP4-01 10 µg

Recombinant Coxiella burnetii Hypothetical membrane spanning protein (CBU_1863), partial

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Hypothetical membrane spanning protein (CBU_1863), partial
CSB-EP4560DXP4-02 50 µg

Recombinant Coxiella burnetii Hypothetical membrane spanning protein (CBU_1863), partial

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Hypothetical membrane spanning protein (CBU_1863), partial
CSB-EP4560DXP4-03 200 µg

Recombinant Coxiella burnetii Hypothetical membrane spanning protein (CBU_1863), partial

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Hypothetical membrane spanning protein (CBU_1863), partial
CSB-EP4560DXP4-04 500 µg

Recombinant Coxiella burnetii Hypothetical membrane spanning protein (CBU_1863), partial

Sign In for Pricing
View Details