Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLRC1 Peptide - N-terminal region

KLRC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD159A, MGC13374, MGC59791, NKG2, NKG2A

UniProt

P26715

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLRC1 Rabbit Polyclonal Antibody (orb584971) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002250

Preservative

Lyophilized powder

AA Sequence

PKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nexinhib 20
TRC-N204050-50MG 50 mg

Nexinhib 20

Sign In for Pricing
View Details
Hexadecyl Bromoacetate-13C2
TRC-H293722-50MG 50 mg

Hexadecyl Bromoacetate-13C2

Sign In for Pricing
View Details
SBF2 Human Gene Knockout Kit (CRISPR)
KN213601BN 1 Kit

SBF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TP53TG3 (NM_016212) Human Recombinant Protein
TP313671M 100 µg

TP53TG3 (NM_016212) Human Recombinant Protein

Sign In for Pricing
View Details
CLPTM1 (NM_001294) Human Over-expression Lysate
LY400516 100 µg

CLPTM1 (NM_001294) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR560344 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details