Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC50A1 Peptide - C-terminal region

SLC50A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SCP, slv, SWEET1, RAG1AP1, HsSWEET1, RP11-540D14.5

UniProt

Q9BRV3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC50A1 Rabbit Polyclonal Antibody (orb326450) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061333

Preservative

Lyophilized powder

AA Sequence

SMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINC00582 Adenovirus (Human)
26860051 1.0 mL

LINC00582 Adenovirus (Human)

Sign In for Pricing
View Details
Menthone-d3
M219132 10 mg

Menthone-d3

Sign In for Pricing
View Details
PBiT2.1-N TK-SmBiT-Nr4a2 Plasmid
PVT74297 2 µg

PBiT2.1-N TK-SmBiT-Nr4a2 Plasmid

Sign In for Pricing
View Details
TRNAT8 Protein Vector (Human) (pPM-C-HA)
PV140364 500 ng

TRNAT8 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Porcine Interleukin-1 receptor 8 ELISA Kit
MBS7277484-01 48 Well

Porcine Interleukin-1 receptor 8 ELISA Kit

Sign In for Pricing
View Details
Porcine Interleukin-1 receptor 8 ELISA Kit
MBS7277484-02 96 Well

Porcine Interleukin-1 receptor 8 ELISA Kit

Sign In for Pricing
View Details