Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC50A1 Peptide - C-terminal region

SLC50A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SCP, slv, SWEET1, RAG1AP1, HsSWEET1, RP11-540D14.5

UniProt

Q9BRV3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC50A1 Rabbit Polyclonal Antibody (orb326450) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061333

Preservative

Lyophilized powder

AA Sequence

SMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PALB2 Antibody - N-terminal region : Biotin (ARP63771_P050-Biotin)
ARP63771_P050-Biotin 100 µL

PALB2 Antibody - N-terminal region : Biotin (ARP63771_P050-Biotin)

Sign In for Pricing
View Details
MIPEP Antibody
C49535-01 50 μL

MIPEP Antibody

Sign In for Pricing
View Details
MIPEP Antibody
C49535-02 100 µL

MIPEP Antibody

Sign In for Pricing
View Details
Rno-miR-675-5p miRNA Agomir
orb1916704-01 5 nmol

Rno-miR-675-5p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-675-5p miRNA Agomir
orb1916704-02 10 nmol

Rno-miR-675-5p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-675-5p miRNA Agomir
orb1916704-03 20 nmol

Rno-miR-675-5p miRNA Agomir

Sign In for Pricing
View Details