ZFYVE21 Peptide - middle region
ZFYVE21 Peptide - middle region
Product Specifications
Product Name Alternative
MGC2550, ZF21
UniProt
Q9BQ24
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZFYVE21 Rabbit Polyclonal Antibody (orb585480) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_076976
Preservative
Lyophilized powder
AA Sequence
CALVSLKEAEFYDKQLKVLLSGATFLVTFGNSEKPETMTCRLSNNQRYLF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880029-100 1x 100 µL
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042848-100 1x 100 µL
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401003-500 1x 500 µL
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details