Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TF Peptide - C-terminal region

TF Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp781D0156, PRO1557, PRO2086, TFQTL1

UniProt

P02787

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TF Rabbit Polyclonal Antibody (orb585487) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001054

Preservative

Lyophilized powder

AA Sequence

IAGKCGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKKSASDLTWDNLKGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1q-C Polyclonal Antibody
JOT-AP01033-01 20 µL

C1q-C Polyclonal Antibody

Sign In for Pricing
View Details
C1q-C Polyclonal Antibody
JOT-AP01033-02 50 μL

C1q-C Polyclonal Antibody

Sign In for Pricing
View Details
C1q-C Polyclonal Antibody
JOT-AP01033-03 100 µL

C1q-C Polyclonal Antibody

Sign In for Pricing
View Details
TXNDC5 Rabbit pAb
E45R20705N 50 ul

TXNDC5 Rabbit pAb

Sign In for Pricing
View Details
Dazap1 (NM_001025742) Rat Untagged Clone
RN215249 10 µg

Dazap1 (NM_001025742) Rat Untagged Clone

Sign In for Pricing
View Details
Rabbit Bicaudal D related protein 1 (CCDC64) ELISA Kit
GTR10339862 96 Well

Rabbit Bicaudal D related protein 1 (CCDC64) ELISA Kit

Sign In for Pricing
View Details